Biotinylated Recombinant Human Fc gamma RIIB/FCGR2B/CD32b Protein

Size

£657.00

SKU:: RP00479B
Additional Names:: CD32|CD32A|CD32b|CDw32|Fc gamma RII|Fc gamma RIIB|FCG2|FcGR|FCGR2|FCGR21|FCGR2A|IGFR2
Molecular Weight:: 32-37 kDa
Purity:: ≥ 95 % as determined by SDS-PAGE;≥ 95 %
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Ala46-Pro217
Formulation:: Biotinylated Recombinant Human Fc gamma RIIB/FCGR2B/CD32b Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala46-Pro217) of Human Fc gamma RIIB/CD32b (Accession #P31994-1) fused with a C-His&Avi tag at the C-terminus.
Species:: Human
Sequence:: APPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAP
Uniprot:: P31994-1
Synonyms:: CD32;CD32B;CDw32;Fc fragment of IgG, low affinity II, receptor for (CD32);Fc fragment of IgG, low affinity IIb, receptor (CD32);Fc fragment of IgG, low affinity IIb, receptor for (CD32);Fc gamma receptor IIb;Fc gamma RIIb;fc-gamma RII-b;Fc-gamma RII-c;fc-gamma-RIIb;Fc-gamma-RIIc;FCG2;FCGR2;FCGR2C;fcRII-b;FcRII-c;IGFR2;igG Fc receptor II-b;IgG Fc receptor II-c;low affinity immunoglobulin gamma Fc region receptor II-b;Low affinity immunoglobulin gamma Fc region receptor II-c
Extra Details:: The Fc gamma Rs have been divided into three classes based on close relationships in their extracellular domains; these groups are designated Fc gamma RI (also known as CD64), Fc gamma RII (CD32), and Fc gamma RIII (CD16). Each group may be encoded by multiple genes and exist in different isoforms depending on species and cell type. The CD64 proteins are high affinity receptors (~10e-8-10e-9 M) capable of binding monomeric IgG, whereas the CD16 and CD32 proteins bind IgG with lower affinities (~10e-6-10e-7 M) only recognizing IgG aggregates surrounding multivalent antigens.

Shipping Conditions:: Blue Ice