Biotinylated Recombinant Human Fc-gamma RIII alpha/FCGR3A/CD16a Protein

Size

£558.45

Was £657.00

SKU:: RP00475B
Additional Names:: CD16|CD16A|Fc gamma RIIIA|FCG3|FCGR3|FCGR3A|FCGRIII|FcgRIIIA|FcR-10|FcRIII|FcRIIIa|IGFR3|IMD20
Molecular Weight:: 48-58 kDa
Purity:: ≥ 95 % as determined by SDS-PAGE;≥ 95 %
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Gly17-Gln208
Formulation:: Biotinylated Recombinant Human Fc-gamma RIII alpha/FCGR3A /CD16a Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly17-Gln208) of Human Fc-gamma RIII alpha/FCGR3A /CD16a (Accession #P08637-1) fused with a C-His&Avi tag at the C-terminus.
Species:: Human
Sequence:: GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQ
Uniprot:: P08637-1
Synonyms:: CD16;CD16A;CD16a antigen;Fc fragment of IgG, low affinity III, receptor for (CD16);Fc fragment of IgG, low affinity IIIa, receptor (CD16a);Fc gamma receptor III-A;Fc-gamma receptor III-2 (CD 16);Fc-gamma receptor IIIb (CD16);Fc-gamma RIII-alpha;FCG3;FcgammaRIIIA;FCGR3;FCGRIII;FCR-10;FCRIII;FCRIIIA;IGFR3;igG Fc receptor III-2;IMD20;immunoglobulin G Fc receptor III;low affinity immunoglobulin gamma Fc region receptor III-A;low affinity immunoglobulin gamma receptor III-a Fc fragment;neutrophil-specific antigen NA
Extra Details:: Human Fc gamma RIIIA/CD16a Protein is a receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis.

Shipping Conditions:: Blue Ice