RP00467
Recombinant Human TNFSF4/OX40 ligand/CD252 Protein
Size
£145.00
- SKU:
- RP00467
- Additional Names:
- CD134L,CD252,GP34,OX-40L,OX40L,TNLG2B,TXGP1,TNFSF4
- Molecular Weight:
- 25-35 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Gln51-Leu183
- Formulation:
- Recombinant Human TNFSF4/OX40 ligand/CD252 Protein is produced by Human cell expression system. The target protein is expressed with sequence (Gln51-Leu183) of human OX40 Ligand/TNFSF4/OX40L/CD252 (Accession #P23510) fused with a 6xHis tag at the N-terminus.
- Species:
- Human
- Sequence:
- QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
- Uniprot:
- P23510
- Synonyms:
- CD134 ligand;CD134L;CD252;glycoprotein Gp34;GP34;OX-40L;OX40 antigen ligand;OX40 ligand;OX4OL;TAX transcriptionally-activated glycoprotein 1;tax-transcriptionally activated glycoprotein 1 (34kD);TNLG2B;tumor necrosis factor (ligand) superfamily member 4;tumor necrosis factor ligand 2B;tumor necrosis factor ligand superfamily member 4;tumor necrosis factor superfamily member 4;TXGP1
- Extra Details:
- This protein belongs a cytokine of the tumor necrosis factor (TNF) ligand family. The encoded protein functions in T cell antigen-presenting cell (APC) interactions and mediates adhesion of activated T cells to endothelial cells. Polymorphisms in this gene have been associated with Sjogren's syndrome and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice