RP00455B
Biotinylated Recombinant Human HMGB1 Protein (Primary Amine Labeling)
Size
£657.00
- SKU:
- RP00455B
- Additional Names:
- HMG-1|HMG1|HMG3|HMGB1|SBP-1
- Molecular Weight:
- 32-36 kDa
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Met1-Glu215
- Formulation:
- Biotinylated Recombinant Human HMGB1 Protein (Primary Amine Labeling) is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Glu215) of Human HMGB1 (Primary Amine Labeling) (Accession #P09429-1) fused with a C-His tag at the C-terminus.
- Species:
- Human
- Sequence:
- MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
- Uniprot:
- P09429-1
- Synonyms:
- Amphoterin;High mobility group protein 1;high mobility group protein B1;high-mobility group (nonhistone chromosomal) protein 1;HMG-1;HMG1;HMG3;SBP-1;Sulfoglucuronyl carbohydrate binding protein
- Extra Details:
- High-mobility group box 1 (HMGB1) is a ubiquitous nuclear protein that promotes inflammation when released extracellularly after cellular activation, stress, damage or death. HMGB1 operates as one of the most intriguing molecules in inflammatory disorders via recently elucidated signal and molecular transport mechanisms. Treatments based on antagonists specifically targeting extracellular HMGB1 have generated encouraging results in a wide number of experimental models of infectious and sterile inflammation.
- Shipping Conditions:
- Blue Ice