RP00452
Recombinant Human Mature TGF-beta 2 Protein
Size
£193.00
- SKU:
- RP00452
- Additional Names:
- TGFB2,G-TSF,LDS4,TGF-beta2
- Molecular Weight:
- 13-15 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Ala303-Ser414
- Formulation:
- Recombinant Human TGF-beta 2 Protein is produced by Human Cell expression system. The target protein is expressed with sequence (Ala303-Ser414) of human TGF-beta 2/TGFB2 (Accession #P61812).
- Species:
- Human
- Sequence:
- ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
- Uniprot:
- P61812
- Synonyms:
- BSC-1 cell growth inhibitor;cetermin;G-TSF;glioblastoma-derived T-cell suppressor factor;LDS4;polyergin;prepro-transforming growth factor beta-2;TGF-beta2;transforming growth factor beta-2 proprotein
- Extra Details:
- This protein belongs a member of the transforming growth factor beta (TGFB) family of cytokines, which are multifunctional peptides that regulate proliferation, differentiation, adhesion, migration, and other functions in many cell types by transducing their signal through combinations of transmembrane type I and type II receptors (TGFBR1 and TGFBR2) and their downstream effectors, the SMAD proteins. Disruption of the TGFB/SMAD pathway has been implicated in a variety of human cancers. The encoded protein is secreted and has suppressive effects of interleukin-2 dependent T-cell growth. Translocation t(1;7)(q41;p21) between this gene and HDAC9 is associated with Peters' anomaly, a congenital defect of the anterior chamber of the eye. The knockout mice lacking this gene show perinatal mortality and a wide range of developmental, including cardiac, defects. Alternatively spliced transcript variants encoding different isoforms have been identified.
- Shipping Conditions:
- Blue Ice