RP00447
Recombinant Human STAT3 Protein
Size
£193.00
- SKU:
- RP00447
- Additional Names:
- ADMIO,ADMIO1,APRF,HIES,STAT3,Stat3 , HIES, ADMIO, ADMIO1
- Molecular Weight:
- 19, 46 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Met1-Asn175
- Formulation:
- Recombinant Human STAT3 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Asn175) of human STAT3 (Accession #P40763) fused with a 6xHis tag at the C-terminus.
- Species:
- Human
- Sequence:
- MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFN
- Uniprot:
- P40763
- Synonyms:
- acute-phase response factor;ADMIO;ADMIO1;APRF;DNA-binding protein APRF;HIES;signal transducer and activator of transcription 3
- Extra Details:
- This protein is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. This protein mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein. Mutations in this gene are associated with infantile-onset multisystem autoimmune disease and hyper-immunoglobulin E syndrome. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
- Shipping Conditions:
- Blue Ice