Biotinylated Recombinant Human IL-3RA/CD123 Protein

Size

£657.00

SKU:: RP00444B
Additional Names:: CD123|IL-3 R alpha|IL-3R subunit alpha|IL-3Ra|IL3R|IL3RA|IL3RAY|IL3RX|IL3RY|MGC34174
Molecular Weight:: 55-65 kDa
Purity:: ≥ 95 % as determined by SDS-PAGE;≥ 95 %
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Thr19-Arg305
Formulation:: Biotinylated Recombinant Human IL-3RA/CD123 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr19-Arg305) of Human IL-3 R alpha/CD123 (Accession #P26951-1) fused with a C-His&Avi tag at the C-terminus.
Species:: Human
Sequence:: TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWR
Uniprot:: P26951-1
Synonyms:: CD123;CD123 antigen;hIL-3Ra;IL-3 receptor subunit alpha;IL-3R subunit alpha;IL-3R-alpha;IL-3RA;IL3R;IL3RAY;IL3RX;IL3RY;interleukin 3 receptor, alpha (low affinity);interleukin-3 receptor subunit alpha
Extra Details:: Interleukin-3 receptor subunit alpha, also known as IL-3 receptor subunit alpha, IL-3R-alpha, CD123, and IL3RA, is a single-pass type I membrane protein which belongs to the type I cytokine receptor family and Type 5 subfamily.The specific alpha subunit of the interleukin-3 receptor (IL-3Ralpha, CD123) is strongly expressed in various leukemic blasts and leukemic stem cells and seems to be an excellent target for the therapy of leukemias.

Shipping Conditions:: Blue Ice