RP00437
Recombinant Human IL-15RA/CD215 Protein
Size
£353.00
- SKU:
- RP00437
- Additional Names:
- CD215|IL-15 R alpha|IL-15RA|MGC104179
- Molecular Weight:
- 70-80 kDa
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Ile31-Thr205
- Formulation:
- Recombinant Human IL-15RA/CD215 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile31-Thr205) of Human IL-15RA/IL-15 R alpha/CD215 (Accession #Q13261-1) fused with a C-hFc tag at the C-terminus.
- Species:
- Human
- Sequence:
- ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT
- Uniprot:
- Q13261-1
- Synonyms:
- CD215;interleukin 15 receptor, alpha;interleukin-15 receptor subunit alpha
- Extra Details:
- Interleukin-15 receptor alpha (IL-15R alpha) is a high affinity IL-15 binding protein that is crucial for mediating IL-15 functions such as memory CD8 T cell proliferation and NK, NK/T cell, and intestinal intraepithelial lymphocyte development.
- Shipping Conditions:
- Blue Ice