Recombinant Human NKG2-D/KLRK1/CD314 Protein

Size

£145.00

SKU:: RP00417
Additional Names:: CD314|KLR|NKG2-D|NKG2D
Molecular Weight:: 20-33 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Phe78-Val216
Formulation:: Recombinant Human NKG2-D/KLRK1/CD314 Protein is produced by Human cell expression system. The target protein is expressed with sequence (Phe78-Val216) of human NKG2D/CD314/KLRK1 (Accession #P26718) fused with a 6xHis tag at the N-terminus.
Species:: Human
Sequence:: FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
Uniprot:: P26718
Synonyms:: CD314;D12S2489E;killer cell lectin-like receptor subfamily K member 1;killer cell lectin-like receptor subfamily K, member 1;KLR;NK cell receptor D;NKG2-D;NKG2-D type II integral membrane protein;NKG2-D-activating NK receptor;NKG2D
Extra Details:: This protein represents naturally occurring read-through transcription between the neighboring KLRC4 (killer cell lectin-like receptor subfamily C, member 4) and KLRK1 (killer cell lectin-like receptor subfamily K, member 1) genes on chromosome 12. The read-through transcript includes an alternate 5' exon and lacks a significant portion of the KLRC4 coding sequence, including the start codon, and it thus encodes the KLRK1 protein.