Recombinant Human CEACAM6/CD66c Protein

Size

£353.00

SKU:: RP00413
Additional Names:: CD66c|CEA|CEACAM6|CEAL|NCA
Molecular Weight:: 55-75 kDa
Purity:: ≥ 95 % as determined by SDS-PAGE;≥ 95 %
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Lys35-Gly320
Formulation:: Recombinant Human CEACAM6/CD66c Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Lys35-Gly320) of Human CEACAM6/CD66c (Accession #P40199) fused with a C-His&Avi tag at the C-terminus.
Species:: Human
Sequence:: KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG
Uniprot:: P40199
Synonyms:: carcinoembryonic antigen related cell adhesion molecule 6;carcinoembryonic antigen-related cell adhesion molecule 6;carcinoembryonic antigen-related cell adhesion molecule 6 (non-specific cross reacting antigen);CD66c;CEAL;Cluster of Differentiation 66c;NCA;Non-specific crossreacting antigen;normal cross-reacting antigen
Extra Details:: Carcinoembryonic antigen-related cell adhesion molecule 6 (CEACAM6) belongs to the human carcino-embryonic antigen (CEA) family. Numerous lines of studies have indicated that altered expression of CEACAM6 may have a role in carcinogenesis and development.

Shipping Conditions:: Blue Ice