Recombinant Human Follistatin/Follistatin 288/FST Protein

Size

£123.25

Was £145.00

SKU:: RP00376
Additional Names:: FST,FS
Molecular Weight:: 95-140 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Gly30-Asn317
Formulation:: Recombinant Human Follistatin/Follistatin 288/FST Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly30-Asn317) of human Follistatin/Follistatin 288/FST (Accession #P19883) with a hFC at the N-terminus.
Species:: Human
Sequence:: GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVC
Uniprot:: P19883
Synonyms:: activin-binding protein;follistatin;FS
Extra Details:: Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicing of the precursor mRNA. In a study in which 37 candidate genes were tested for linkage and association with polycystic ovary syndrome (PCOS) or hyperandrogenemia in 150 families, evidence was found for linkage between PCOS and follistatin.