Biotinylated Recombinant Human TNFRSF4/OX40/CD134 Protein

Size

£657.00

SKU:: RP00363B
Additional Names:: ACT-135|CD134|IMD16|Ly-70|OX40|OX40 homologue|OX40L receptor|TNFRSF4|TXGP1L
Molecular Weight:: 50-55 kDa
Purity:: ≥ 95 % as determined by SDS-PAGE;≥ 95 %
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Leu29-Ala216
Formulation:: Biotinylated Recombinant Human TNFRSF4/OX40/CD134 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu29-Ala216) of Human OX40/TNFRSF4/CD134 (Accession #P43489) fused with a C-His&Avi tag at the C-terminus.
Species:: Human
Sequence:: LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA
Uniprot:: P43489
Synonyms:: ACT35;ACT35 antigen;ATC35 antigen;CD134;CD134 antigen;IMD16;lymphoid activation antigene ACT35;OX40;OX40 antigen;OX40 cell surface antigen;OX40 homologue;OX40L receptor;TAX transcriptionally-activated glycoprotein 1 receptor;tax-transcriptionally activated glycoprotein 1 receptor;tumor necrosis factor receptor superfamily member 4;TXGP1L
Extra Details:: Tumor necrosis factor receptor superfamily, member 4 (TNFRSF4), also known as CD134 and OX40 receptor. OX40 is a secondary co-stimulatory immune checkpoint molecule, expressed after 24 to 72 hours following activation; its ligand, OX40L, is also not expressed on resting antigen presenting cells, but is following their activation.

Shipping Conditions:: Blue Ice