Recombinant Human LILRB2/ILT-4/CD85d Domain1&2 Protein

Size

£353.00

SKU:: RP00340
Additional Names:: CD85d|ILT-4|ILT4|ILT4CD85d|LILRB2|LIR2|MIR10
Molecular Weight:: 25-30 kDa
Purity:: ≥ 95 % as determined by SDS-PAGE;≥ 95 %
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Gln22-Val229
Formulation:: Recombinant Human LILRB2/ILT-4/CD85d Domain1&2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln22-Val229) of Human LILRB2/CD85d/ILT4 Domain1&2 (Accession #Q8N423-1) fused with a C-His tag at the C-terminus.
Species:: Human
Sequence:: QTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSV
Uniprot:: Q8N423-1
Synonyms:: CD85 antigen-like family member D;CD85D;Ig-like transcript 4;ILT-4;ILT4;Immunoglobulin-like transcript 4;leucocyte Ig-like receptor B2;leukocyte immunoglobulin-like receptor subfamily B member 2;leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 2;LIR-2;LIR2;MIR-10;MIR10;monocyte/macrophage immunoglobulin-like receptor 10;myeloid inhibitory receptor 10
Extra Details:: The immunoglobulin-like transcript (ILT) comprise a family of activating and inhibitory type immunoreceptors whose genes are located in the same locus that encodes killer cell Ig-like receptors (KIR). ILT4, also known as LIR-2 and LILRB2, is a type I transmembrane protein expressed primarily on monocytes and dendritic cells (DC). LILRB2 is a receptor for class I MHC antigens. Recognizes a broad spectrum of HLA-A, HLA-B, HLA-C, HLA-G and HLA-F alleles.

Shipping Conditions:: Blue Ice