RP00324B
Biotinylated Recombinant Human TREM2 Protein

Size
£657.00
- SKU:
- RP00324B
- Additional Names:
- B7-H|B7-H1|B7H1|CD274|PD-L1|PD-L1B7 homolog 1|PDCD1L1|PDCD1LG1|PDL1
- Molecular Weight:
- 30-45 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- His19-Ser174
- Formulation:
- Biotinylated Recombinant Human TREM2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His19-Ser174) of Human TREM2 (Accession #Q9NZC2-1) fused with a C-His&Avi tag at the C-terminus.
- Species:
- Human
- Sequence:
- HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS
- Uniprot:
- Q9NZC2-1
- Synonyms:
- PLOSL2;TREM-2;Trem2a;Trem2b;Trem2c;triggering receptor expressed on monocytes 2;triggering receptor expressed on myeloid cells 2;triggering receptor expressed on myeloid cells 2a
- Extra Details:
- TREM-2 (Triggering Receptor Expressed on Myeloid cells-2) is a 35 kDa type I transmembrane member of the TREM family and Ig superfamily. Mature human TREM-2? consists of a 156 amino acid (aa) extracellular domain (ECD) with one V-type Ig-like domain, a 21 aa transmembrane (TM) domain, and a 35 aa cytoplasmic tail. TREM-2 forms a receptor signaling complex with TYROBP which mediates signaling and cell activation following ligand binding (PubMed:10799849). Acts as a receptor for amyloid-beta protein 42, a cleavage product of the amyloid-beta precursor protein APP, and mediates its uptake and degradation by microglia.
- Shipping Conditions:
- Blue Ice



