Recombinant Human CCL24/Eotaxin-2 Protein

Size

£145.00

SKU:: RP00318
Additional Names:: CCL24,Ckb-6,MPIF-2,MPIF2,SCYA24
Molecular Weight:: 10-15 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Val27-Cys119
Formulation:: Recombinant Human CCL24/Eotaxin-2 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Val27-Cys119) of human CCL24/Eotaxin-2 (Accession #O00175) fused with no additional amino acid.
Species:: Human
Sequence:: VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC
Uniprot:: O00175
Synonyms:: C-C motif chemokine 24;chemokine (C-C motif) ligand 24;CK-beta-6;Ckb-6;eosinophil chemotactic protein 2;eotaxin-2;MPIF-2;MPIF2;myeloid progenitor inhibitory factor 2;SCYA24;small inducible cytokine subfamily A (Cys-Cys), member 24;small-inducible cytokine A24
Extra Details:: Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity on resting T lymphocytes, a minimal activity on neutrophils, and is negative on monocytes and activated T lymphocytes. The protein is also a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line.