Biotinylated Recombinant Human SLAMF7/CRACC/CD319 Protein

Size

£657.00

SKU:: RP00305B
Additional Names:: 19A|CD2 subset 1|CD319|CRACC|CS1|FOAP-12|Novel Ly9|SLAMF7
Molecular Weight:: 40-60 kDa
Purity:: ≥ 95 % as determined by SDS-PAGE;≥ 95 %
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Ser23-Met226
Formulation:: Biotinylated Recombinant Human SLAMF7/CRACC/CD319 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser23-Met226) of Human SLAMF7/CRACC/CD319 (Accession #Q9NQ25-1) fused with a C-His&Avi tag at the C-terminus.
Species:: Human
Sequence:: SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSM
Uniprot:: Q9NQ25-1
Synonyms:: 19A;19A24 protein;CD2 subset 1;CD2-like receptor activating cytotoxic cells;CD2-like receptor-activating cytotoxic cells;CD319;CRACC;CS1;membrane protein FOAP-12;Novel Ly9;novel LY9 (lymphocyte antigen 9) like protein;protein 19A;SLAM family member 7
Extra Details:: CD2-like receptor activating cytotoxic cells (CRACC), also known as CS1, novel Ly9, SLAMF7, and CD319, is a 65-75 kDa type I transmembrane glycoprotein in the SLAM subgroup of the CD2 family.Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response.

Shipping Conditions:: Blue Ice