Recombinant Human Fc-gamma RIII beta/FCGR3B/CD16b Protein

Size

£123.25

Was £145.00

SKU:: RP00291
Additional Names:: FCGR3B,CD16,CD16b,FCG3,FCGR3,FCR-10,FCRIII,FCRIIIb
Molecular Weight:: 40-55 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Thr20-Gln208
Formulation:: Recombinant Human Fc-gamma RIII beta/FCGR3B/CD16b Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr20-Gln208) of human Fc gamma RIIIB/CD16b (Accession #NP_000561.3) fused with a 6xHis tag at the C-terminus.
Species:: Human
Sequence:: TEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNENLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQ
Uniprot:: O75015
Synonyms:: CD16;CD16A;CD16b;Fc fragment of IgG, low affinity IIIb, receptor (CD16b);Fc gamma receptor III-B;Fc gamma receptor IIIb;Fc-gamma receptor IIIb (CD 16);fc-gamma RIII-beta;fc-gamma RIIIb;FCG3;FCGR3;FCGR3A;FCR-10;FCRIII;FCRIIIb;igG Fc receptor III-1;low affinity immunoglobulin gamma Fc region receptor III-B
Extra Details:: CD16 is a low affinity Fc receptor, and has been identified as Fc receptors FcG GammaRIIIa (CD16a) and FcG GammaRIIIb (CD16b). These receptors function in the activation or inhibition of immune responses. CD16 encoded by two different highly homologous genes in a cell type-specific manner.CD16 is found on the surface of natural killer cells, neutrophil polymorphonuclear leukocytes, monocytes and macrophages. CD16B is also kown as FCGR3B and FCG3B, is expressed specifically by polymorphonuclear leukocytes (neutrophils) and stimulated eosinophils. CD16B is the low affinity receptor for the Fc region of immunoglobulins gamma. CD16B may serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.

Shipping Conditions:: Blue Ice