RP00286
Recombinant Human VSIG4 Protein
Size
£181.00
- SKU:
- RP00286
- Additional Names:
- CRIg,Z39IG,VSIG4,VSIG4,CRIg,Z39IG,VSIG4
- Molecular Weight:
- 60-70 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Arg20-Pro283
- Formulation:
- Recombinant Human VSIG4 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Arg20-Pro283) of human VSIG4 (Accession #NP_009199.1) fused with an Fc, 6xHis tag at the C-terminus.
- Species:
- Human
- Sequence:
- RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLP
- Uniprot:
- Q9Y279-1
- Synonyms:
- complement receptor of the immunoglobulin superfamily;CRIg;Ig superfamily protein;protein Z39Ig;V-set and immunoglobulin domain-containing protein 4;Z39IG
- Shipping Conditions:
- Blue Ice