Recombinant Human NKG2D ligand 2/ULBP2 Protein

Size

£127.00

SKU:: RP00267
Additional Names:: ULBP2,ALCAN-alpha,N2DL2,NKG2DL2,RAET1H
Molecular Weight:: 60-70 kDa
Purity:: ≥90%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Gly26-Ser217
Formulation:: Recombinant Human NKG2D ligand 2/ULBP2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly26-Ser217) of human ULBP2 (Accession #NP_079493.1) fused with an Fc, 6xHis tag at the C-terminus.
Species:: Human
Sequence:: GRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSS
Uniprot:: Q9BZM5
Synonyms:: ALCAN-alpha;N2DL2;NKG2D ligand 2;NKG2DL2;RAET1H;RAET1L;retinoic acid early transcript 1H;retinoic acid early transcript 1L;UL16-binding protein 2
Extra Details:: ULBP2 Protein, Human, Recombinant (His Tag) consists of 203 amino acids with a molecular weight of 23.2 kDa. The apparent molecular mass of recombinant human ULBP2 is about 33 kDa in SDS-PAGE under reducing conditions because of glycosylation.NKG2D ligand 2 is cell membrane protein belonging to theMHC class I family.The gene for ULBP-2 resides in a cluster of ten related genes, six of which encode potentially functional glycoproteins. ULBPs are known to bind to human NKG2D, an activating receptor expressed on NK cells, NKT cells, gamma D Delta T cells, and CD8+ alpha beta T cells, resulting in the production of cytokines and chemokines. Binding of ULBPs ligands to NKG2D induces calcium mobilization and activation of the JAK2, STAT5, ERK and PI3K kinase/Akt signal transduction pathway.ULBP2 / N2DL-2 is not expressed in normal tissues, but in various types of cancer cell lines and the fetus and has been implicated in tumor surveillance.

Shipping Conditions:: Blue Ice