Recombinant Human THSD1 Protein

Size

£115.00

SKU:: RP00253
Additional Names:: THSD1
Molecular Weight:: 55-70 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Glu25-Ile361
Formulation:: Recombinant Human THSD1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu 25 - Ile 361 ) of human THSD1 (Accession #NP_954872.1) fused with a 6xHis tag at the C-terminus.
Species:: Human
Sequence:: EYLLLREPGHVALSNDTVYVDFQYFDGANGTLRNVSVLLLEANTNQTVTTKYLLTNQSQGTLKFECFYFKEAGDYWFTMTPEATDNSTPFPWWEKSAFLKVEWPVFHVDLNRSAKAAEGTFQVGLFTSQPLCPFPVDKPNIVVDVIFTNSLPEARRNSRQPLEIRTSKRTELAQGQWVEFGCAPLGPEAYVTVVLKLLGRDSVITSTGPIDLAQKFGYKLVMVPELTCESGVEVTVLPPPCTFVQGVVTVFKEAPRYPGKRTIHLAENSLPLGERRTIFNCTLFDMGKNKYCFDFGISSRSHFSAKEECMLIQRNTAFQPSSPSPLQPQGPVKSNNI
Uniprot:: Q9NS62-2
Synonyms:: 4833423O18Rik;ANIB12;thrombospondin type-1 domain-containing protein 1;thrombospondin, type I, domain containing 1;TMTSP;transmembrane molecule with thrombospondin module;UNQ3010
Extra Details:: Human Thrombospondin type-1 domain-containing protein 1 (THSD1) also known as Transmembrane molecule with thrombospondin module (TMTSP), is a single-pass type I membrane protein. In addition, THSD1 is widely expressed on endothelial cells, with highest expression in the lung. THSD1's ligand and function are unknown, but it is postulated that THSD1 may be involved in the regulation of vasculogenesis and/or angiogenesis through its interaction with its specific ligand.

Shipping Conditions:: Blue Ice