Recombinant Human TNFRSF1B/TNF-R2/CD120b Protein

Size

£181.00

SKU:: RP00252
Additional Names:: CD120b,TBPII,TNF-R-II,TNF-R75,TNFBR,TNFR1B,TNFR2,TNFR80,p75,p75TNFR,TNF Receptor II,TNFRSF1B
Molecular Weight:: 38-50 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Leu23-Asp257
Formulation:: Recombinant Human TNFRSF1B/TNF-R2/CD120b Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu 23 - Asp 257) of human TNFR2 (Accession #NP_001057.1) fused with a 6xHis tag at the C-terminus.
Species:: Human
Sequence:: LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD
Uniprot:: P20333
Synonyms:: CD120b;p75;p75 TNF receptor;p75TNFR;p80 TNF-alpha receptor;soluble TNFR1B variant 1;TBPII;TNF-R-II;TNF-R2;TNF-R75;TNF-RII;TNFBR;TNFR1B;TNFR2;TNFR80;tumor necrosis factor beta receptor;tumor necrosis factor binding protein 2;tumor necrosis factor receptor 2;tumor necrosis factor receptor superfamily member 1B;tumor necrosis factor receptor type II