Recombinant Human Growth hormone receptor/GHR Protein

Size

£353.00

SKU:: RP00251
Additional Names:: GHR,GHBP,GHIP
Molecular Weight:: 70-85 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Ala27-Tyr264
Formulation:: Recombinant Human Growth hormone receptor/GHR Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ala 27 - Tyr 264 ) of human Growth Hormone Receptor (GHR) (Accession #NP_000154.1) fused with an Fc, 6xHis tag at the C-terminus.
Species:: Human
Sequence:: AILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFY
Uniprot:: P10912
Synonyms:: GH receptor;GHBP;GHIP;growth hormone binding protein;growth hormone receptor;mutant growth hormone receptor;serum binding protein;somatotropin receptor;truncated growth hormone receptor