Recombinant Human Fc-epsilon RI-alpha/FCER1A Protein

Size

£133.00

SKU:: RP00246
Additional Names:: FCER1A,FCE1A,FcERI
Molecular Weight:: 38-50 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Val26-Gln205
Formulation:: Recombinant Human Fc-epsilon RI-alpha/FCER1A Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val26-Gln205) of human Fc epsilon RI alpha (Accession #NP_001992) fused with a 6xHis tag at the C-terminus.
Species:: Human
Sequence:: VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ
Uniprot:: P12319
Synonyms:: Fc epsilon receptor Ia;Fc epsilon RI alpha-chain;Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide;Fc IgE receptor, alpha polypeptide;Fc-epsilon RI-alpha;FCE1A;FcERI;high affinity immunoglobulin epsilon receptor alpha-subunit;high affinity immunoglobulin epsilon receptor subunit alpha;igE Fc receptor subunit alpha;immunoglobulin E receptor, high-affinity, of mast cells, alpha polypeptide
Extra Details:: FCER1A is the alpha subunit of the immunoglobulin epsilon receptor (IgE receptor). IgE receptor is a high affinity IgE receptor which plays a central role in allergic disease, coupling allergen and mast cell to initiate the inflammatory and immediate hypersensitivity responses that are characteristic of disorders such as hay fever and asthma. The allergic response occurs when 2 or more IgE receptors are crosslinked via IgE molecules that in turn are bound to an allergen (antigen) molecule. A perturbation occurs that brings about the release of histamine and proteases from the granules in the cytoplasm of the mast cell and leads to the synthesis of prostaglandins and leukotrienes--potent effectors of the hypersensitivity response. IgE receptor is comprised of an alpha subunit(FcERI), a beta subunit, and two gamma subunits. FcERI is glycosylated and contains 2 Ig-like (immunoglobulin-like) domains.

Shipping Conditions:: Blue Ice