Recombinant Human NKG2D ligand 3/ULBP3 Protein

Size

£193.00

SKU:: RP00240
Additional Names:: ULBP3
Molecular Weight:: 55-60 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Gly27-Pro216
Formulation:: Recombinant Human NKG2D ligand 3/ULBP3 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gly27-Pro216) of human ULBP-3 (Accession #NP_078794) fused with an Fc, 6xHis tag at the C-terminus.
Species:: Human
Sequence:: GRADAHSLWYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSDKVLSMGHLEEQLYATDAWGKQLEMLREVGQRLRLELADTELEDFTPSGPLTLQVRMSCECEADGYIRGSWQFSFDGRKFLLFDSNNRKWTVVHAGARRMKEKWEKDSGLTTFFKMVSMRDCKSWLRDFLMHRKKRLEPTAPPTMAP
Uniprot:: Q9BZM4
Synonyms:: ALCAN-gamma;N2DL-3;NKG2D ligand 3;NKG2DL3;RAET1N;retinoic acid early transcript 1N;UL16-binding protein 3
Extra Details:: ULBP-3 is a member of a family of cell-surface proteins that function as ligands for human NKG2D. ULBP-3 has also been described under the names RaeT1N (retinoic acid early transcript), NKG2DL3, and ALCAN-gamma. The name ULBP-3 derives from the original identification of three proteins, ULBP-1, -2, and -3, as ligands for the human cytomegalovirus glycoprotein UL16; they were designated UL16 binding proteins (ULBP). The gene for ULBP-3 resides in a cluster of ten related genes, six of which encode potentially functional glycoproteins. Amino acid sequence identity within this family ranges from 30-60%. These proteins are distantly related to MHC class I proteins, but they possess only the alpha 1 and alpha 2 Ig-like domains, and they have no capacity to bind peptide or interact with beta 2-microglobulin. Some family members, including ULBP-3, are anchored to the membrane via a GPI-linkage, whereas others have transmembrane domains.

Shipping Conditions:: Blue Ice