RP00237
Recombinant Human IGFBP-1 Protein

Size
£145.00
- SKU:
- RP00237
- Additional Names:
- AFBP, IBP1, IGF-BP25, PP12, hIGFBP-1,IGFBP1,IBP1,IGF-BP25,PP12,hIGFBP-1
- Molecular Weight:
- 20-30 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Ala26-Asn259
- Formulation:
- Recombinant Human IGFBP-1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala26-Asn259) of human IGFBP-1 (Accession #NP_000587.1) fused with a 6xHis tag at the C-terminus.
- Species:
- Human
- Sequence:
- APWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN
- Uniprot:
- P08833
- Synonyms:
- AFBP;alpha-pregnancy-associated endometrial globulin;amniotic fluid binding protein;binding protein-25;binding protein-26;binding protein-28;growth hormone independent-binding protein;hIGFBP-1;IBP-1;IBP1;IGF-binding protein 1;IGF-BP25;IGFBP-1;insulin-like growth factor-binding protein 1;placental protein 12;PP12
- Extra Details:
- The superfamily of insulin-like growth factor (IGF) binding proteins include the six high-affinity IGF binding proteins (IGFBP) and at least four additional low-affinity binding proteins referred to as IGFBP related proteins (IGFBP-rP). All IGFBP superfamily members are cysteine-rich proteins with conserved cysteine residues, which are clustered in the amino- and carboxy-terminal thirds of the molecule. IGFBPs modulate the biological activities of IGF proteins. Some IGFBPs may also have intrinsic bioactivity that is independent of their ability to bind IGF proteins. Post-transitional modifications of IGFBP, including glycosylation, phosphorylation and proteolysis, have been shown to modify the affinities of the binding proteins to IGF.
- Shipping Conditions:
- Blue Ice



