Recombinant Human Kallikrein-8/KLK8 Protein

Size

£193.00

SKU:: RP00226
Additional Names:: KLK8, HNP, NP, NRPN, PRSS19, TADG14, kallikrein-8,Kallikrein 8,HNP,NP,NRPN,PRSS19,TADG14
Molecular Weight:: 35-40 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Gln29-Gly260
Formulation:: Recombinant Human Kallikrein-8/KLK8 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln29-Gly260) of human KLK-8/Kallikrein-8 (Accession #NP_009127.1) fused with a 6xHis tag at the C-terminus.
Species:: Human
Sequence:: QEDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHCKKPKYTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKG
Uniprot:: O60259
Synonyms:: HNP;kallikrein-8;Neuropsin;NP;NRPN;ovasin;PRSS19;serine protease 19;serine protease TADG-14;TADG14;tumor-associated differentially expressed gene 14 protein
Extra Details:: Kallikrein-8, also known as Neuropsin, Serine protease 19, Serine protease TADG-14, Tumor-associated differentially expressed gene 14 protein and KLK8, is a secreted protein which belongs to the peptidase S1 family and Kallikrein subfamily. It is a serine protease which is capable of degrading a number of proteins such as casein, fibrinogen, kininogen, fibronectin and collagen type IV. Kallikrein-8 / KLK8 is involved in skin desquamation and keratinocyte proliferation and plays a role in the secondary phase of pathogenesis following spinal cord injury. Kallikrein-8 / KLK8 is expressed at high levels in serum, ascites fluid and tumor cytosol of advanced stage ovarian cancer patients and may serve as a marker of ovarian cancer.

Shipping Conditions:: Blue Ice