Recombinant Human MMP-13 Protein

Size

£163.00

SKU:: RP00221
Additional Names:: CLG3, MANDP1, MDST, MMP-13,MMP13,MANDP1,MDST,MMP-13
Molecular Weight:: 55-70 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Leu20-Cys471
Formulation:: Recombinant Human MMP-13 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu20-Cys471) of human MMP-13 (Accession #NP_002418.1) fused with a 6xHis tag at the C-terminus.
Species:: Human
Sequence:: LPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENAASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
Uniprot:: P45452
Synonyms:: CLG3;collagenase 3;MANDP1;matrix metalloproteinase 13 (collagenase 3);Matrix metalloproteinase-13;MDST;MMP-13
Extra Details:: Matrix metalloproteinases are a family of zinc and calcium dependent endopeptidases. MMP-13 (Collagenase-3) has been demonstrated to degrade a range of extracellular matrix proteins, including collagen types I, II, III, IV, IX, X and XIV, gelatin, aggrecan, perlecan and fibronectin. MMP-13 is proteolytically processed to generate the mature protease. MMP-13 is distinguished from the other human collagenases ,it cleaves type II collagen more efficiently than types I and III. MMP-13 is expressed by fibroblasts, chrondrocytes and squamous epithelial cells. It may be involved in articular cartilage turnover and cartilage pathophysiology associated with osteoarthritis.

Shipping Conditions:: Blue Ice