Recombinant Human MMP-1 Protein

Size

£193.00

SKU:: RP00211
Additional Names:: MMP1,CLG,CLGN
Molecular Weight:: 55-60 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Phe20-Asn469
Formulation:: Recombinant Human MMP1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe20-Asn469) of human MMP1 (Accession #NP_002412.1) fused with a 6xHis tag at the C-terminus.
Species:: Human
Sequence:: FPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
Uniprot:: P03956
Synonyms:: CLG;CLGN;fibroblast collagenase;interstitial collagenase;matrix metallopeptidase 1 (interstitial collagenase);matrix metalloprotease 1;Matrix metalloproteinase-1
Extra Details:: MMP1, also known as MMP-1, contains 4 hemopexin-like domains and is a member of the matrix metalloproteinase (MMP) family. Matrix metalloproteases, also called matrixins, are zinc-dependent endopeptidases that are the major proteases involved in ECM degradation. MMPs are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. MMP1 is expressed by fibroblasts, keratinocytes, endothelial cells, monocytes and macrophages.Mutations of MMP1 are associated with chronic obstructive pulmonary disease (COPD).

Shipping Conditions:: Blue Ice