Recombinant Human Angiopoietin-like 7/ANGPTL7(27-346) Protein

Size

£123.25

Was £145.00

SKU:: RP00206
Additional Names:: ANGPTL7,AngX,CDT6,dJ647M16.1
Molecular Weight:: 35-45,45-60kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Gln27-Pro346
Formulation:: Recombinant Human Angiopoietin-like 7/ANGPTL7(27-346) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln27-Pro346) of human Angiopoietin-like 7 (Accession #NP_066969.1) fused with a 6xHis tag at the C-terminus.
Species:: Human
Sequence:: QKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKP
Uniprot:: O43827
Synonyms:: Angiopoietin-like factor;angiopoietin-like factor (CDT6);angiopoietin-like protein 7;angiopoietin-related protein 7;AngX;CDT6;cornea-derived transcript 6 protein;dJ647M16.1
Extra Details:: Angiopoietin-like 7 (ANGPTL7), also known as Corneal-Derived Transcript 6 (CDT6), is a secreted glycoprotein that is structurally related to the angiopoietins. ANGPTL7 is expressed in the corneal stroma, trabecular meshwork, and sclera and is elevated in glaucoma aqueous humor. Its production is up regulated in trabecular meshwork cells by glucocorticoids and TGF-beta and in cartilage by TNF-alpha. Overexpression of ANGPTL7 in trabecular meshwork cells inhibits the production of collagen and proteoglycans . When overexpressed in tumor cells it promotes collagen and proteoglycan deposition but inhibits tumor xenograft progression and tumor angiogenesis.

Shipping Conditions:: Blue Ice