Recombinant Human TNFSF11/RANKL/CD254 Protein

Size

£163.00

SKU:: RP00183
Additional Names:: TNFSF11,CD254,ODF,OPGL,OPTB2,RANKL, TNLG6B,TRANCE,hRANKL2,sOdf
Molecular Weight:: 35 kDa
Purity:: ≥ 95 % as determined by SDS-PAGE;≥ 90 %
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Gly136-Asp317
Formulation:: Recombinant Human TNFSF11/RANKL/CD254 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly136-Asp317) of human TRANCE/RANK L/TNFSF11 (Accession #NP_143026.1) fused with a 6xHis tag at the N-terminus.
Species:: Human
Sequence:: GSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID
Uniprot:: O14788
Synonyms:: CD254;hRANKL2;ODF;OPGL;OPTB2;osteoclast differentiation factor;osteoprotegerin ligand;RANKL;receptor activator of nuclear factor kappa B ligand;Receptor activator of nuclear factor kappa-B ligand;sOdf;TNF-related activation-induced cytokine;TNLG6B;TRANCE;tumor necrosis factor (ligand) superfamily, member 11;tumor necrosis factor ligand 6B;tumor necrosis factor ligand superfamily member 11;tumor necrosis factor superfamily member 11
Extra Details:: Tumor necrosis factor ligand superfamily member 11, also known as Receptor activator of nuclear factor kappa-B ligand, Osteoprotegerin ligand, TNFSF11, RANKL, TRANCE, OPGL and CD254, is a single-pass type II membrane protein which belongs to the tumor necrosis factor family. TNFSF11 is a ligand for osteoprotegerin and functions as a key factor for osteoclast differentiation and activation. TNFSF11 was shown to be a dentritic cell survival factor and is involved in the regulation of T cell-dependent immune response. T cell activation was reported to induce expression of this gene and lead to an increase of osteoclastogenesis and bone loss. This protein was shown to activate antiapoptotic kinase AKT/PKB through a signaling complex involving SRC kinase and tumor necrosis factor receptor-associated factor (TRAF) 6, which indicated this protein may have a role in the regulation of cell apoptosis. Targeted disruption of the related gene in mice led to severe osteopetrosis and a lack of osteoclasts. The deficient mice exhibited defects in early differentiation of T and B lymphocytes, and failed to form lobulo-alveolar mammary structures during pregnancy.

Shipping Conditions:: Blue Ice