Recombinant Human TNFRSF11B/Osteoprotegerin Protein

Size

£115.00

SKU:: RP00180
Additional Names:: TNFRSF11B, OCIF, OPG, PDB5, TR1, TNF receptor superfamily member 11b,Osteoprotegerin,OCIF,OPG,PDB5,TR1
Molecular Weight:: 55-65 kDa
Purity:: ≥ 95 % as determined by SDS-PAGE;≥95 %
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Glu22-Leu401
Formulation:: Recombinant Human TNFRSF11B/Osteoprotegerin Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Glu22-Leu401) of human Osteoprotegerin/TNFRSF11B (Accession #NP_002537.3) fused with a 6xHis tag at the C-terminus.
Species:: Human
Sequence:: ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL
Uniprot:: O00300
Synonyms:: OCIF;OPG;osteoclastogenesis inhibitory factor;osteoprotegerin;PDB5;TR1;tumor necrosis factor receptor superfamily member 11B;tumor necrosis factor receptor superfamily, member 11b
Extra Details:: Osteoprotegerin or TNFRSF11B is a member of the TNF-receptor superfamily. This protein is an osteoblast-secreted decoy receptor that functions as a negative regulator of bone resorption. This protein specifically binds to its ligand, osteoprotegerin ligand, both of which are key extracellular regulators of osteoclast development. Studies of the mouse counterpart also suggest that this protein and its ligand play a role in lymph-node organogenesis and vascular calcification.

Shipping Conditions:: Blue Ice