Recombinant Human IL-12A/IL-12 p35 Protein

Size

£193.00

SKU:: RP00173
Additional Names:: P35, CLMF, NFSK, NKSF1, IL-12A,IL12A
Molecular Weight:: 70 kda
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Arg23-Ser219
Formulation:: Recombinant Human IL-12A/IL-12 p35 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Arg23-Ser219) of human IL12A/NKSF1 (Accession #NP_002178.2) fused with an Fc, 6xHis tag at the C-terminus.
Species:: Human
Sequence:: RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
Uniprot:: P29459
Synonyms:: CLMF;CLMF p35;cytotoxic lymphocyte maturation factor 1, p35;cytotoxic lymphocyte maturation factor 35 kDa subunit;IL-12 subunit p35;IL-12, subunit p35;IL-12A;IL35 subunit;interleukin 12, p35;interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35);interleukin-12 alpha chain;interleukin-12 subunit alpha;NF cell stimulatory factor chain 1;NFSK;NK cell stimulatory factor chain 1;NKSF1;P35
Extra Details:: Interleukin-12 subunit alpha (IL12A/IL-12p35) is also known as Cytotoxic lymphocyte maturation factor 35 kDa subunit, cytotoxic lymphocyte maturation factor 1, p35, NK cell stimulatory factor chain 1, and interleukin-12 alpha chain. IL12A/IL-12p35 is a subunit of a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. The cytokine is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that is a member of the cytokine receptor family. This cytokine is required for the T-cell-independent induction of interferon (IFN)-gamma, and is important for the differentiation of both Th1 and Th2 cells. The responses of lymphocytes to this cytokine are mediated by the activator of transcription protein STAT4. Nitric oxide synthase 2A (NOS2A/NOS2) is found to be required for the signaling process of this cytokine in innate immunity.

Shipping Conditions:: Blue Ice