Recombinant Human IL-18BP Protein

Size

£240.00

SKU:: RP00162
Additional Names:: IL18BP,IL18BPa
Molecular Weight:: 60-75 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Thr31-Gly194
Formulation:: Recombinant Human IL-18BP Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Thr31-Gly194) of human IL18BPa (Accession #NP_001034748.1) fused with an Fc, 6xHis tag at the C-terminus.
Species:: Human
Sequence:: TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG
Uniprot:: O95998
Synonyms:: FVH;IL18BPa;interleukin-18-binding protein;MC51L-53L-54L homolog gene product;tadekinig-alfa
Extra Details:: Interleukin-18-binding protein (IL-18BP) is a constitutively expressed and secreted protein. IL-18BP is a cytokine receptor that belongs to the interleukin 1 receptor family. This receptor specifically binds interleukin 18 (IL18), prevents the binding of IL18 to its receptor, and thus inhibits IL18-induced IFN-gamma production, resulting in reduced T-helper type 1 immune responses. This protein is constitutively expressed and secreted in mononuclear cells. Elevated level of this protein is detected in the intestinal tissues of patients with Crohn's disease.