Recombinant Human CD5 Protein

Size

£133.00

SKU:: RP00158
Additional Names:: CD5, LEU1, T1, CD5 molecule,LEU1,T1
Molecular Weight:: 50 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Arg25-Asn371
Formulation:: Recombinant Human CD5 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg25-Asn371) of human CD5 (Accession #NP_055022.2) fused with a 6xHis tag at the C-terminus.
Species:: Human
Sequence:: RLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPN
Uniprot:: P06127
Synonyms:: CD5 antigen (p56-62);epididymis secretory sperm binding protein;LEU1;lymphocyte antigen T1/Leu-1;T-cell surface glycoprotein CD5;T1
Extra Details:: CD5, also known as Leu-1, Ly-1, and T1, is a 67 kDa transmembrane glycoprotein in the scavenger receptor superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. This protein is a type-I transmembrane glycoprotein found on the surface of thymocytes, T lymphocytes and a subset of B lymphocytes. The encoded protein contains three SRCR domains and may act as a receptor to regulate T-cell proliferation.

Shipping Conditions:: Blue Ice