Recombinant Human IGFBP-6 Protein

Size

£145.00

SKU:: RP00145
Additional Names:: IGFBP6,IBP6
Molecular Weight:: 35-40 kDa
Purity:: ≥ 95 % as determined by SDS-PAGE;≥95 %
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Met1-Gly240
Formulation:: Recombinant Human IGFBP-6 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Gly240) of human IGFBP6/IBP-6 (Accession #NP_002169.1) fused with a 6xHis tag at the C-terminus.
Species:: Human
Sequence:: MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG
Uniprot:: P24592
Synonyms:: IBP-6;IBP6;IGF binding protein 6;IGFBP-6;insulin-like growth factor-binding protein 6
Extra Details:: The superfamily of insulin-like growth factor (IGF) binding proteins include the six high-affinity IGF binding proteins (IGFBP) and at least four additional low-affinity binding proteins referred to as IGFBP related proteins (IGFBP-rP). All IGFBP superfamily members are cysteine-rich proteins with conserved cysteine residues, they can bind IGF-I and IGF-II with the equal affinity. Insulin-like growth factor (IGF) binding proteins (IGFBPs) have been shown to either inhibit or enhance the action of IGF, or act in an IGF-independent manner in the prostate. IGF-binding protein-4 (IGFBP-4) inhibits IGF-I action in vitro and is the most abundant IGFBP in the rodent arterial wall. IGFBP6 is directly downregulated by the beta-catenin/TCF complex in desmoid tumors, and imply a role for the IGF axis in the proliferation of desmoid tumors. There is mounting evidence that the structure of the IGFBP proteins plays a key role in the regulation of IGF bioavailability, by modulating its molecular size, capillary membrane permeability, target tissue specificity, cell membrane adherence and IGF affinity.

Shipping Conditions:: Blue Ice