Recombinant Human FGFR-3 alpha (IIIc)/CD333 Protein

Size

£223.00

SKU:: RP00144
Additional Names:: ACH,CD333,CEK2,HSFGFR3EX,JTK4,FGFR3
Molecular Weight:: 100-120 kDa
Purity:: ≥90%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Glu23-Gly375
Formulation:: Recombinant Human FGFR-3 alpha (IIIc)/CD333 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Glu23-Gly375) of human FGFR3/CD333 (Accession #NP_000133.1) fused with an Fc, 6xHis tag at the C-terminus.
Species:: Human
Sequence:: ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAG
Uniprot:: P22607
Synonyms:: ACH;CD333;CEK2;FGFR-3;fibroblast growth factor receptor 3;fibroblast growth factor receptor 3 variant 4;fibroblast growth factor receptor 3-S;HSFGFR3EX;hydroxyaryl-protein kinase;JTK4;tyrosine kinase JTK4
Extra Details:: FGFR3, also known as CD333, is a member of the fibroblast growth factor receptor (FGFR) family, with its amino acid sequence being highly conserved between members and among divergent species. FGFR family members differ from one another in their ligand affinities and tissue distribution. FGFRs are transmembrane catalytic receptors that have intracellular tyrosine kinase activity. A full-length representative protein would consist of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member binds acidic and basic fibroblast growth hormone and plays a role in bone development and maintenance. Mutations in FGFR3 gene lead to craniosynostosis and multiple types of skeletal dysplasia.

Shipping Conditions:: Blue Ice