Recombinant Human Erythropoietin R/EPO-R Protein

Size

£133.00

SKU:: RP00111
Additional Names:: EPOR,EPO-R
Molecular Weight:: 55-60 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Ala25-Pro250
Formulation:: Recombinant Human Erythropoietin R/EPO-R Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ala25-Pro250) of human EPO Receptor/EPOR (Accession #NP_000112.1) fused with an Fc, 6xHis tag at the C-terminus.
Species:: Human
Sequence:: APPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDP
Uniprot:: P19235
Synonyms:: EPO-R;erythropoietin receptor;truncated erythropoietin receptor
Extra Details:: This protein is erythropoietin receptor which is a member of the cytokine receptor family. Upon erythropoietin binding, this receptor activates Jak2 tyrosine kinase which activates different intracellular pathways including: Ras/MAP kinase, phosphatidylinositol 3-kinase and STAT transcription factors. The stimulated erythropoietin receptor appears to have a role in erythroid cell survival. Defects in the erythropoietin receptor may produce erythroleukemia and familial erythrocytosis. Dysregulation of this gene may affect the growth of certain tumors. Alternate splicing results in multiple transcript variants.

Shipping Conditions:: Blue Ice