Recombinant Human IL-10 Protein

Size

£145.00

SKU:: RP00093
Additional Names:: CSIF, GVHDS, IL-10, IL10A, TGIF,IL10,GVHDS,IL-10,IL10A,TGIF
Molecular Weight:: 18 kDa
Purity:: ≥90%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Ser19-Asn178
Formulation:: Recombinant Human IL-10 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ser19-Asn178) of human IL10/Interleukin-10 (Accession #NP_000563.1) fused with a 6xHis tag at the C-terminus.
Species:: Human
Sequence:: SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Uniprot:: P22301
Synonyms:: CSIF;cytokine synthesis inhibitory factor;GVHDS;IL-10;IL10A;interleukin-10;T-cell growth inhibitory factor;TGIF
Extra Details:: The protein encoded by this gene is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes. This cytokine has pleiotropic effects in immunoregulation and inflammation. It down-regulates the expression of Th1 cytokines, MHC class II Ags, and costimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. This cytokine can block NF-kappa B activity, and is involved in the regulation of the JAK-STAT signaling pathway. Knockout studies in mice suggested the function of this cytokine as an essential immunoregulator in the intestinal tract. Mutations in this gene are associated with an increased susceptibility to HIV-1 infection and rheumatoid arthritis.

Shipping Conditions:: Blue Ice