Recombinant Human CD69 Protein

Size

£133.00

SKU:: RP00077
Additional Names:: CD69,AIM,BL-AC/P26,CLEC2C,EA1,GP32/28,MLR-3
Molecular Weight:: 15-35 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Ser62-Lys199
Formulation:: Recombinant Human CD69 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ser 62 - Lys 199 ) of human CD69 (Accession #NP_001772.1) fused with a 6xHis tag at the C-terminus.
Species:: Human
Sequence:: SVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK
Uniprot:: Q07108
Synonyms:: Activation inducer molecule;activation inducer molecule (AIM/CD69);AIM;BL-AC/P26;C-type lectin domain family 2 member C;C-type lectin domain family 2, member C;CD69 antigen (p60, early T-cell activation antigen);CLEC2C;EA1;early activation antigen CD69;early lymphocyte activation antigen;early T-cell activation antigen p60;GP32/28;leukocyte surface antigen Leu-23;MLR-3
Extra Details:: Early activation antigen CD69, also known as activation inducer molecule (AIM), is a single-pass type II membrane protein. Recently, cDNA clones encoding human and mouse CD69 were isolated and showed CD69 to be a member of the C-type lectin superfamily. It is one of the earliest cell surface antigens expressed by T cells following activation. Once expressed, CD69 acts as a costimulatory molecule for T cell activation and proliferation. In addition to mature T cells, CD69 is inducibly expressed by immature thymocytes, B cells, natural killer (NK) cells, monocytes, neutrophils and eosinophils, and is constitutively expressed by mature thymocytes and platelets. CD69 is involved in lymphocyte proliferation and functions as a signal transmitting receptor in lymphocytes, natural killer (NK) cells, and platelets. The structure, chromosomal localization, expression and function of CD69 suggest that it is likely a pleiotropic immune regulator , potentially important in the activation and differentiation of a wide variety of hematopoietic cells. This membrane molecule transiently expresses on activated lymphocytes, and its selective expression in inflammatory infiltrates suggests that it plays a role in the pathogenesis of inflammatory diseases. CD69 plays a crucial role in the pathogenesis of allergen-induced eosinophilic airway inflammation and hyperresponsiveness and that CD69 could be a possible therapeutic target for asthmatic patients.

Shipping Conditions:: Blue Ice