RP00064
Recombinant Human FGF-12 Protein
Size
£133.00
- SKU:
- RP00064
- Additional Names:
- FGF12,EIEE47,FGF12B,FHF1
- Molecular Weight:
- 18-25 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Met1-Thr181
- Formulation:
- Recombinant Human FGF-12 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Thr181) of human FGF-12 (Accession #NP_004104.3) fused with a 6xHis tag at the C-terminus.
- Species:
- Human
- Sequence:
- MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST
- Uniprot:
- P61328
- Synonyms:
- DEE47;EIEE47;FGF12B;FHF1;fibroblast growth factor 12;fibroblast growth factor 12B;fibroblast growth factor FGF-12b;fibroblast growth factor homologous factor 1;myocyte-activating factor
- Extra Details:
- The protein is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This growth factor lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfected into mammalian cells, this protein accumulated in the nucleus, but was not secreted.
- Shipping Conditions:
- Blue Ice