Recombinant Human Bcl-2 Protein

Size

£145.00

SKU:: RP00062
Additional Names:: BCL2, Bcl-2, PPP1R50, apoptosis regulator Bcl-2,Bcl-2,PPP1R50
Molecular Weight:: 25-30 kDa
Purity:: ≥90%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Ala2-Asp211
Formulation:: Recombinant Human Bcl-2 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala2-Asp211) of human BCL2 (Accession #NP_000624.2) fused with no tags.
Species:: Human
Sequence:: AHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFD
Uniprot:: P10415
Synonyms:: apoptosis regulator Bcl-2;B-cell CLL/lymphoma 2;Bcl-2;PPP1R50;protein phosphatase 1, regulatory subunit 50
Extra Details:: This protein is an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma.