RP00052
Recombinant Human IL-8/CXCL8/GCP-1 Protein
Size
£133.00
- SKU:
- RP00052
- Additional Names:
- CXCL8,GCP-1,GCP1,IL8,LECT,LUCT,LYNAP,MDNCF,MONAP,NAF,NAP-1,NAP1
- Molecular Weight:
- 10 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Ala23-Ser99
- Formulation:
- Recombinant Human IL-8/CXCL8/GCP-1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala23-Ser99) of human IL-8 (Accession #NP_000575.1).
- Species:
- Human
- Sequence:
- AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
- Uniprot:
- P10145
- Synonyms:
- alveolar macrophage chemotactic factor I;beta endothelial cell-derived neutrophil activating peptide;beta-thromboglobulin-like protein;C-X-C motif chemokine 8;chemokine (C-X-C motif) ligand 8;emoctakin;GCP-1;GCP1;granulocyte chemotactic protein 1;IL8;interleukin 8;interleukin-8;LECT;LUCT;lung giant cell carcinoma-derived chemotactic protein;lymphocyte derived neutrophil activating peptide;LYNAP;MDNCF;MONAP;monocyte-derived neutrophil chemotactic factor;monocyte-derived neutrophil-activating peptide;NAF;NAP-1;NAP1;neutrophil-activating peptide 1;Neutrophil-activating protein 1;Protein 3-10C;SCYB8;small inducible cytokine subfamily B, member 8;T-cell chemotactic factor;tumor necrosis factor-induced gene 1
- Extra Details:
- The protein is a member of the CXC chemokine family. This chemokine is one of the major mediators of the inflammatory response. This chemokine is secreted by several cell types. It functions as a chemoattractant, and is also a potent angiogenic factor. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection.
- Shipping Conditions:
- Blue Ice