RP00050
Recombinant Human IL-11 Protein

Size
£145.00
- SKU:
- RP00050
- Additional Names:
- IL11,AGIF,IL-11
- Molecular Weight:
- 21 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Pro22-Leu199
- Formulation:
- Recombinant Human IL-11 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Pro22-Leu199) of human IL-11 (Accession #NP_000632.1) fused with an initial Met at the N-terminus.
- Species:
- Human
- Sequence:
- PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
- Uniprot:
- P20809
- Synonyms:
- adipogenesis inhibitory factor;AGIF;IL-11;interleukin-11;oprelvekin
- Extra Details:
- The protein is a member of the gp130 family of cytokines. These cytokines drive the assembly of multisubunit receptor complexes, all of which contain at least one molecule of the transmembrane signaling receptor IL6ST (gp130). This cytokine is shown to stimulate the T-cell-dependent development of immunoglobulin-producing B cells. It is also found to support the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells.
- Shipping Conditions:
- Blue Ice



