Recombinant Human Sulfotransferase 1A1/SULT1A1 Protein

Size

£193.00

SKU:: RP00037
Additional Names:: SULT1A1,HAST1/HAST2,P-PST,PST,ST1A1,ST1A3,STP,STP1,TSPST1
Molecular Weight:: 32 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Met1-Leu295
Formulation:: Recombinant Human Sulfotransferase 1A1/SULT1A1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Leu295) of human SULT1A1 (Accession #NP_001046.2) fused with a 6xHis tag at the C-terminus.
Species:: Human
Sequence:: MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Uniprot:: P50225
Synonyms:: aryl sulfotransferase 1;HAST1/HAST2;P-PST;P-PST 1;Phenol sulfotransferase 1;phenol-sulfating phenol sulfotransferase 1;PST;ST1A1;ST1A3;STP;STP1;sulfotransferase 1A1;sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1;Thermostable phenol sulfotransferase;thermostable phenol sulfotransferase1;ts-PST;TSPST1
Extra Details:: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds.Particularly SULT1A1 (Sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1), a member of the sulfotransferase 1 subfamily, which is a major pathway for drug metabolism in humans. Statistically significant associations were observed between the SULT1A1 genotype (Arg213His) and age, obesity and certain neoplasias (mammary, pulmonary, esophageal and urothelial cancer). Furthermore, the polymorphism of the SULT1A1 may be closely associated with breast cancer.

Shipping Conditions:: Blue Ice