RP00036
Recombinant Human Thioredoxin/SASP/TXN Protein
Size
£107.00
- SKU:
- RP00036
- Additional Names:
- TRDX, TRX, TRX1,TXN,TRX,TRX1
- Molecular Weight:
- 15 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Val2-Val105
- Formulation:
- Recombinant Human Thioredoxin/SASP/TXN Protein is produced by E. coli expression system. The target protein is expressed with sequence (Val2-Val105) of human Thioredoxin (Accession #NP_003320.2) fused with a 6xHis tag at the C-terminus.
- Species:
- Human
- Sequence:
- VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
- Uniprot:
- P10599
- Synonyms:
- ADF;ATL-derived factor;SASP;surface-associated sulphydryl protein;testicular tissue protein Li 199;thioredoxin;thioredoxin delta 3;TRDX;TRX;TRX1;Trx80;TXN delta 3
- Extra Details:
- Thioredoxin, also known as ATL-derived factor, Surface-associated sulphydryl protein, SASP and TXN, is a nucleus, cytoplasm and secreted protein which belongs to the thioredoxin family. Trx-1 is the only extracellular occurring thioredoxin, and is secreted by lymphocytes, hepatocytes, fibroblasts, and several tumor cells. Plasma concentrations of Trx-1 are up to 6 nM . In cells, Trx-1 is localized predominantly in the cytoplasm. Small amounts have been detected in the nucleus and in association with the outside surface of the cells. Biological functions of Trx-1 include growth factor activity, antioxidant properties, a cofactor that provides reducing equivalents, and transcriptional regulation.
- Shipping Conditions:
- Blue Ice