Recombinant Human BID Protein

Size

£133.00

SKU:: RP00021
Additional Names:: BID,FP497
Molecular Weight:: 18-25 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Met1-Asp195
Formulation:: Recombinant Human BID Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Asp195) of human BID (Accession #NP_001187.1) fused with a 6xHis tag at the C-terminus.
Species:: Human
Sequence:: MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD
Uniprot:: P55957
Synonyms:: apoptic death agonist;BH3-interacting domain death agonist;desmocollin type 4;FP497;Human BID coding sequence;p22 BID
Extra Details:: The BH3 interacting domain death agonist (BID) is a pro-apoptotic member of the Bcl-2 protein family, which contains only the BH3 domain, and is required for its interaction with the Bcl-2 family proteins and for its pro-death activity. BID is important to cell death mediated by these proteases and thus is the sentinel to protease-mediated death signals. It is a mediator of mitochondrial damage induced by caspase-8 (CASP8); CASP8 cleaves this encoded protein, and the COOH-terminal part translocates to mitochondria where it triggers cytochrome c release.