Recombinant Human IL-36 beta/IL-1F8 Protein

Size

£163.00

SKU:: RP00020
Additional Names:: FIL1,FIL1-(ETA),FIL1H,FILI-(ETA),IL-1F8,IL-1H2,IL1-ETA,IL1F8,IL1H2,IL36B
Molecular Weight:: 18-25 kDa
Purity:: ≥90%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Arg5-Glu157
Formulation:: Recombinant Human IL-36 beta/IL-1F8 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Arg5-Glu157) of human IL-36 beta (Accession #NP_775270.1) fused with a 6xHis tag at the C-terminus.
Species:: Human
Sequence:: REAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE
Uniprot:: Q9NZH7
Synonyms:: family of interleukin 1-eta;FIL1;FIL1 eta;FIL1-(ETA);FIL1H;FILI-(ETA);IL-1 eta;IL-1F8;IL-1F8 (FIL1-eta);IL-1H2;IL1-ETA;IL1F8;IL1F8 (Canonical product IL-1F8a);IL1H2;interleukin 1 family, member 8 (eta);interleukin-1 eta;interleukin-1 family member 8;interleukin-1 homolog 2;Interleukin-1 Superfamily e;interleukin-36 beta
Extra Details:: Interleukin-1 family member 8(IL1F8) also known as IL36B, is a member of the interleukin 1(IL-1) cytokine family. IL-36 beta is expressed by keratinocytes, naive CD4+ T cells, neurons, and glia. It is up-regulated in keratinocytes and synovial fibroblasts by inflammatory stimulation and in psoriatic lesions. IL-36 beta promotes inflammatory responses by enhancing the activation and Th1 polarization of dendritic cells and T cells. It also enhances the production of multiple pro-inflammatory cytokines, chemokines, and anti-bacterial defensin peptides by keratinocytes, synovial fibroblasts, and articular chondrocytes. IL-1 family members exert their effects through binding to receptors that belong to the IL-1 receptor (IL-1R) family.

Shipping Conditions:: Blue Ice