RP00017
Recombinant Human VEGF-A/VEGF121(K321N) Protein
Size
£145.00
- SKU:
- RP00017
- Additional Names:
- VEGFA, MVCD1, VEGF, VPF, vascular endothelial growth factor A,MVCD1,VEGF,VPF,L VEGFA,VEGF A
- Molecular Weight:
- 18 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Ala207-Arg327(K321N)
- Formulation:
- Recombinant Human VEGF-A/VEGF121(K321N) Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala207-Arg327 (Lys321Asn)) of human VEGF121 (Accession #NP_001020541.2).
- Species:
- Human
- Sequence:
- APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENCDKPRR
- Uniprot:
- P15692
- Synonyms:
- MVCD1;vascular endothelial growth factor A;vascular endothelial growth factor A121;vascular endothelial growth factor A165;vascular permeability factor;VEGF;VPF
- Extra Details:
- This protein is a member of the PDGF/VEGF growth factor family. It encodes a heparin-binding protein, which exists as a disulfide-linked homodimer. This growth factor induces proliferation and migration of vascular endothelial cells, and is essential for both physiological and pathological angiogenesis. Disruption of this gene in mice resulted in abnormal embryonic blood vessel formation. This protein is upregulated in many known tumors and its expression is correlated with tumor stage and progression. Elevated levels of this protein are found in patients with POEMS syndrome, also known as Crow-Fukase syndrome.
- Shipping Conditions:
- Blue Ice