RP00011
Recombinant Human IFN-alpha 1/13(Q114A) Protein
Size
£133.00
- SKU:
- RP00011
- Additional Names:
- IFNA1,IFL,IFN,IFN-ALPHA,IFN-alphaD,IFNA13,IFNA
- Molecular Weight:
- 18 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Cys24-Glu189(Q114A)
- Formulation:
- Recombinant Human IFN-alpha 1/13(Q114A) Protein is produced by E. coli expression system. The target protein is expressed with sequence (Cys24-Glu189 (Ala114)) of human IFNA1 (Accession #NP_076918.1) fused with an initial Met at the N-terminus and a 6xHis tag at the C-terminus.
- Species:
- Human
- Sequence:
- CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYAQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE
- Uniprot:
- P01562
- Synonyms:
- IFL;IFN;IFN-ALPHA;IFN-alpha-1/13;IFN-alphaD;IFNA@;IFNA13;interferon alpha 1b;interferon alpha-1/13;interferon alpha-D;interferon-alpha1;leIF D
- Extra Details:
- IFNA1, also known as IFN-alpha and IFNA, belongs to the alpha/beta interferon family. Interferons(IFNs) are proteins made and released by host cells in response to the presence of pathogens such as viruses, bacteria, parasites or tumor cells.Leukocyte interferon is produced predominantly by B lymphocytes. Immune interferon is produced by mitogen- or antigen-stimulated T lymphocytes. IFNA1 is produced by macrophages and has has both anti-viral and immunomodulatory activities on target cells.
- Shipping Conditions:
- Blue Ice