Recombinant Human HMGB1 Protein

Size

£145.00

SKU:: RP00010
Additional Names:: HMG-1,HMG1,HMG3,SBP-1,HMGB1
Molecular Weight:: 30 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Met1-Glu215
Formulation:: Recombinant Human HMGB1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Glu215) of human HMGB1 (Accession #NP_002119.1) fused with a 6xHis tag at the C-terminus.
Species:: Human
Sequence:: MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
Uniprot:: P09429
Synonyms:: Amphoterin;High mobility group protein 1;high mobility group protein B1;high-mobility group (nonhistone chromosomal) protein 1;HMG-1;HMG1;HMG3;SBP-1;Sulfoglucuronyl carbohydrate binding protein
Extra Details:: High-mobility group box 1 protein (HMGB1), also known as HMG-1 or amphoterin previously, is a member of the HMGB family consisting of three members, HMGB1, HMGB2 and HMGB3. Posttranslational modification of HMGB1, including acetylation, phosphorylation, and methylation, affects HMGB1 localization, receptor interactions, and bioactivity. HMGB1 can be localized to the nucleus or cytoplasm and can also be secreted despite its lack of a signal peptide. HMGB1 binds DNA in a non-sequence specific manner and may act as a structural cofactor during gene transcription.Acetylation of HMGB1 results in its cytoplasmic localization and eventual secretion. HMGB1 can be secreted by multiple cell types, and it is also released upon cell necrosis, apoptosis, and pyroptosis.

Shipping Conditions:: Blue Ice